PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_012563-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family HD-ZIP
Protein Properties Length: 316aa    MW: 35742.3 Da    PI: 4.5842
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_012563-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.45.7e-1956109356
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      k+++++ +q+++Le+ Fe ++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  AHYPO_012563-RA  56 KKRRLSVDQVKALERNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWK 109
                      566899***********************************************9 PP

2HD-ZIP_I/II130.28.2e-4255147193
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                      ekkrrls +qvk+LE++Fe e+kLeperKv+la+eLglqprqvavWFqnrRAR+ktkqlE+dy +Lk+++d+lk++ e+L++++++L +++ke
  AHYPO_012563-RA  55 EKKRRLSVDQVKALERNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDYGVLKASFDTLKHNYESLQHDKDDLLKQIKE 147
                      69***************************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.84E-1934113IPR009057Homeodomain-like
PROSITE profilePS5007117.29751111IPR001356Homeobox domain
SMARTSM003898.2E-1854115IPR001356Homeobox domain
PfamPF000463.5E-1656109IPR001356Homeobox domain
CDDcd000863.08E-1656112No hitNo description
Gene3DG3DSA:1.10.10.608.9E-2058118IPR009057Homeodomain-like
PRINTSPR000318.8E-68291IPR000047Helix-turn-helix motif
PROSITE patternPS00027086109IPR017970Homeobox, conserved site
PRINTSPR000318.8E-691107IPR000047Helix-turn-helix motif
PfamPF021839.1E-17111152IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MKRLGSSDSL GALVSMCPAS DDQSPRNNMY SRDYQSMLDG LDEDGCLEET GHVPEKKRRL  60
SVDQVKALER NFEVENKLEP ERKVKLAQEL GLQPRQVAVW FQNRRARWKT KQLERDYGVL  120
KASFDTLKHN YESLQHDKDD LLKQIKELKS KLNEEINSES DNDVSIKQEV LVFESDDHIN  180
TKAIESLSSG SEEEEAELLK VKQHVFAESK DGSDSDSSAI LNDDNSPNAS NSSIFQTQQQ  240
LLMSPISSSP PSINGFNFSE SRSDGLGSIP NNNNVYHPHL VKIEEHNFFS GEEACNFFSE  300
EQAPSLHWYC PDPWT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1103111RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010681015.11e-153PREDICTED: homeobox-leucine zipper protein ATHB-6-like
TrEMBLA0A0J8C9D11e-153A0A0J8C9D1_BETVU; Uncharacterized protein
STRINGVIT_07s0191g00180.t011e-123(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.19e-66homeobox protein 16